PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10026116m
Common NameEUTSA_v10026116mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family MIKC_MADS
Protein Properties Length: 241aa    MW: 27452.2 Da    PI: 8.9607
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10026116mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF88.34e-28959151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     kri+n++ rqvtfskRrng+lKKA+EL +LCdaev viifsstg+ly++ss
  Thhalv10026116m  9 KRIDNSTSRQVTFSKRRNGLLKKAKELAILCDAEVGVIIFSSTGRLYDFSS 59
                     79***********************************************96 PP

2K-box80.83.2e-2779170798
            K-box   7 ksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                      +s  +++ + +q+e+a Lk++++nLq+++R+++Ge+L+ Ls+++Lq+Le+qLe sl+ +R kK+++l+e+i+el +  + +++en +L+kk+
  Thhalv10026116m  79 ESSPASEIKFWQKESAILKRQLHNLQENHRQMMGEELSGLSVEDLQKLENQLELSLRGVRMKKDQMLVEEIQELYREGNLVHQENLDLHKKV 170
                      55678899**********************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.071161IPR002100Transcription factor, MADS-box
SMARTSM004324.3E-40160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.22E-32285IPR002100Transcription factor, MADS-box
CDDcd002652.81E-44276No hitNo description
PRINTSPR004042.1E-28323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003192.8E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-283859IPR002100Transcription factor, MADS-box
PfamPF014866.5E-2582170IPR002487Transcription factor, K-box
PROSITE profilePS5129715.34886176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010440Biological Processstomatal lineage progression
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MGRGKIAIKR IDNSTSRQVT FSKRRNGLLK KAKELAILCD AEVGVIIFSS TGRLYDFSSS  60
SMKSVIERYR DAKGDSNLES SPASEIKFWQ KESAILKRQL HNLQENHRQM MGEELSGLSV  120
EDLQKLENQL ELSLRGVRMK KDQMLVEEIQ ELYREGNLVH QENLDLHKKV NLMHQKNIEL  180
QKKVSEVEGV KSADKSSLLT NGLDMIRDNS SEHVHLQLSQ PQHDETQAKA IQQSYFSFIA  240
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P5e-19169169Myocyte-specific enhancer factor 2B
1tqe_Q5e-19169169Myocyte-specific enhancer factor 2B
1tqe_R5e-19169169Myocyte-specific enhancer factor 2B
1tqe_S5e-19169169Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00410DAPTransfer from AT3G57230Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0300460.0BT030046.1 Arabidopsis thaliana At3g57230 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006412254.11e-175hypothetical protein EUTSA_v10026116mg
SwissprotA2RVQ51e-152AGL16_ARATH; Agamous-like MADS-box protein AGL16
TrEMBLV4MEN41e-175V4MEN4_EUTSA; Uncharacterized protein
STRINGBra017638.1-P1e-150(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53024105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57230.11e-153AGAMOUS-like 16